Loading...
Statistics
Advertisement

Service4Logistic
www.eksprestransport.pl/

Eksprestransport.pl

Advertisement
Conversion Technology Metas Server
Eksprestransport.pl is hosted in Poland . Eksprestransport.pl uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 2. First javascripts: Jquery.js, Google.js, Number of used analytics tools: 0. Its server type is: IdeaWebServer/v0.80.

Technologies in use by Eksprestransport.pl

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • jQuery

Advertisement

Javascripts

Number of occurences: 2
  • jquery.js
  • google.js

Server Type

  • IdeaWebServer/v0.80

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Eksprestransport.pl

SSL certificate

    • name: /OU=GT16304841/OU=See www.rapidssl.com/resources/cps (c)15/OU=Domain Control Validated - RapidSSL(R)/CN=*.home.pl
    • subject:
      • OU:
        • 0: GT16304841
        • 1: See www.rapidssl.com/resources/cps (c)15
        • 2: Domain Control Validated - RapidSSL(R)
      • CN: *.home.pl
    • hash: 86b7fd64
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 271391
    • validFrom: 150504164626Z
    • validTo: 180505151453Z
    • validFrom_time_t: 1430757986
    • validTo_time_t: 1525533293
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.home.pl, DNS:home.pl
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal

Meta - Eksprestransport.pl

Number of occurences: 4
  • Name:
    Content: text/html; charset=utf-8
  • Name: Description
    Content:
  • Name: HandheldFriendly
    Content: true
  • Name: viewport
    Content: width=device-width, minimumscale=1.0, maximum-scale=1.0

Server / Hosting

  • IP: 79.96.238.137
  • Latitude: 52.24
  • Longitude: 21.04
  • Country: Poland

Rname

  • dns2.home.pl
  • dns3.home.pl
  • dns.home.pl
  • eksprestransport.pl

Target

  • admin.home.pl

HTTP Header Response

HTTP/1.1 200 OK Date: Thu, 30 Jun 2016 13:29:45 GMT Content-Type: text/html; charset=utf-8 Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Expires: Thu, 19 Nov 1981 08:52:00 GMT Pragma: no-cache Server: IdeaWebServer/v0.80 Set-Cookie: s4l=1885390fc4082719e146252225a80c68; path=/ X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

DNS

host: eksprestransport.pl
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 79.96.238.137
host: eksprestransport.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns2.home.pl
host: eksprestransport.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns3.home.pl
host: eksprestransport.pl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns.home.pl
host: eksprestransport.pl
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: dns.home.pl
  5. rname: admin.home.pl
  6. serial: 1443712438
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: eksprestransport.pl
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: eksprestransport.pl

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ksprestransport.pl, www.exksprestransport.pl, www.xksprestransport.pl, www.esksprestransport.pl, www.sksprestransport.pl, www.ewksprestransport.pl, www.wksprestransport.pl, www.erksprestransport.pl, www.rksprestransport.pl, www.efksprestransport.pl, www.fksprestransport.pl, www.evksprestransport.pl, www.vksprestransport.pl, www.ecksprestransport.pl, www.cksprestransport.pl, www.eqksprestransport.pl, www.qksprestransport.pl, www.eaksprestransport.pl, www.aksprestransport.pl, www.eyksprestransport.pl, www.yksprestransport.pl, www.esprestransport.pl, www.ektsprestransport.pl, www.etsprestransport.pl, www.eksprestransport.pl, www.esprestransport.pl, www.ekgsprestransport.pl, www.egsprestransport.pl, www.ekbsprestransport.pl, www.ebsprestransport.pl, www.eknsprestransport.pl, www.ensprestransport.pl, www.ekhsprestransport.pl, www.ehsprestransport.pl, www.ekysprestransport.pl, www.eysprestransport.pl, www.eklsprestransport.pl, www.elsprestransport.pl, www.ekosprestransport.pl, www.eosprestransport.pl, www.ekusprestransport.pl, www.eusprestransport.pl, www.ekisprestransport.pl, www.eisprestransport.pl, www.ekmsprestransport.pl, www.emsprestransport.pl, www.ekprestransport.pl, www.ekseprestransport.pl, www.ekeprestransport.pl, www.ekswprestransport.pl, www.ekwprestransport.pl, www.eksdprestransport.pl, www.ekdprestransport.pl, www.eksxprestransport.pl, www.ekxprestransport.pl, www.eksfprestransport.pl, www.ekfprestransport.pl, www.eksgprestransport.pl, www.ekgprestransport.pl, www.ekstprestransport.pl, www.ektprestransport.pl, www.eksrestransport.pl, www.ekspirestransport.pl, www.eksirestransport.pl, www.ekspkrestransport.pl, www.ekskrestransport.pl, www.ekspurestransport.pl, www.eksurestransport.pl, www.ekspjrestransport.pl, www.eksjrestransport.pl, www.eksplrestransport.pl, www.ekslrestransport.pl, www.ekspestransport.pl, www.ekspriestransport.pl, www.ekspiestransport.pl, www.eksproestransport.pl, www.ekspoestransport.pl, www.eksprlestransport.pl, www.eksplestransport.pl, www.eksprlestransport.pl, www.eksplestransport.pl, www.ekspr.estransport.pl, www.eksp.estransport.pl, www.eksprstransport.pl, www.eksprexstransport.pl, www.eksprxstransport.pl, www.ekspresstransport.pl, www.eksprsstransport.pl, www.eksprewstransport.pl, www.eksprwstransport.pl, www.eksprerstransport.pl, www.eksprrstransport.pl, www.eksprefstransport.pl, www.eksprfstransport.pl, www.eksprevstransport.pl, www.eksprvstransport.pl, www.eksprecstransport.pl, www.eksprcstransport.pl, www.ekspreqstransport.pl, www.eksprqstransport.pl, www.ekspreastransport.pl, www.eksprastransport.pl, www.ekspreystransport.pl, www.eksprystransport.pl, www.ekspretransport.pl, www.ekspresetransport.pl, www.ekspreetransport.pl, www.ekspreswtransport.pl, www.eksprewtransport.pl, www.ekspresdtransport.pl, www.ekspredtransport.pl, www.ekspresxtransport.pl, www.eksprextransport.pl, www.ekspresftransport.pl, www.ekspreftransport.pl, www.ekspresgtransport.pl, www.ekspregtransport.pl, www.ekspresttransport.pl, www.eksprettransport.pl, www.ekspresransport.pl, www.eksprestqransport.pl, www.ekspresqransport.pl, www.eksprestaransport.pl, www.ekspresaransport.pl, www.eksprest ransport.pl, www.ekspres ransport.pl, www.eksprestwransport.pl, www.ekspreswransport.pl, www.ekspresteransport.pl, www.ekspreseransport.pl, www.eksprestzransport.pl, www.ekspreszransport.pl, www.eksprestxransport.pl, www.ekspresxransport.pl, www.eksprestcransport.pl, www.eksprescransport.pl, www.eksprestansport.pl, www.eksprestriansport.pl, www.eksprestiansport.pl, www.eksprestroansport.pl, www.eksprestoansport.pl, www.eksprestrlansport.pl, www.eksprestlansport.pl, www.eksprestrlansport.pl, www.eksprestlansport.pl, www.eksprestr.ansport.pl, www.eksprest.ansport.pl, www.eksprestrnsport.pl, www.eksprestraonsport.pl, www.eksprestronsport.pl, www.eksprestrapnsport.pl, www.eksprestrpnsport.pl, www.eksprestra9nsport.pl, www.eksprestr9nsport.pl, www.eksprestransport.pl, www.eksprestrnsport.pl, www.eksprestrainsport.pl, www.eksprestrinsport.pl, www.eksprestraunsport.pl, www.eksprestrunsport.pl, www.eksprestrasport.pl, www.eksprestrannsport.pl, www.eksprestransport.pl, www.eksprestranhsport.pl, www.eksprestrahsport.pl, www.eksprestranjsport.pl, www.eksprestrajsport.pl, www.eksprestranksport.pl, www.eksprestraksport.pl, www.eksprestranlsport.pl, www.eksprestralsport.pl, www.eksprestran sport.pl, www.eksprestra sport.pl,

Other websites we recently analyzed

  1. cnfocus
    Beijing (China) - 114.113.158.13
    Server software: Apache/2.2.8 (Win32) PHP/5.2.6
    Technology: CSS, Html, Php
    Number of Javascript: 2
    Number of meta tags: 2
  2. 拉索城堡官方网站
    拉索城堡-----世界因我而不同，官方客服电话：4006-120-289。1
    Central District (Hong Kong) - 121.127.234.105
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 3
    Number of meta tags: 3
  3. iri.hs.kr
    Korea, Republic of - 211.210.30.141
    Server software:
    Technology: Javascript
  4. saltlakevalleycarpetcleaning.info
    Scottsdale (United States) - 184.168.221.42
    Server software:
    Technology: Html, Html5, Iframe
  5. Zenfolio | JL Photo & Design
    Jessica Lingenfelter Photography & Design provides graphic design work and artistic pictures and portraits with a modern and vintage flair. See our website for portfolios and pricing. Located in Neosho, MO.
    Europe - 95.100.248.121
    Server software:
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  6. maplelab
    Italy - 92.223.209.197
    Server software: Microsoft-IIS/7.5
    Technology: Html, Javascript, Google Analytics
    Number of meta tags: 2
  7. Дом здоровья "Оберег"
    Дом здоровья "Оберег"
    Russian Federation - 185.42.12.3
    Server software: nginx/1.0.15
    Technology: Carousel, CSS, Html, Javascript, jQuery, Php, LiveInternet counter
    Number of Javascript: 8
    Number of meta tags: 4
  8. MMM Investments
    India - 103.241.181.75
    Server software: Microsoft-IIS/8.0
    Technology: CSS, Html
  9. CSTL - Colloque santé des troupeaux laitiers
    CSTL est une organisation sans but lucratif afin de promouvoir la santé pour les troupeaux laitiers
    Saint-hyacinthe (Canada) - 24.226.183.176
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript
    Number of meta tags: 3
  10. Telephone & Data Network - South West & London | React O Call Ltd
    We provide and install telephone systems, fibre optics and data network solutions in the South West & Greater London, call on 020 8909 5814
    United States - 93.184.220.60
    Server software: Tomahawk Ultra
    Technology: CSS, Html, Javascript, jQuery Cookie, jQuery UI, JW Player, Php, Omniture, SiteCatalyst
    Number of Javascript: 14
    Number of meta tags: 6

Check Other Websites